Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Med29 Peptide - middle region

Med29 Peptide - middle region

Product Specifications

Product Name Alternative

2810405O22Rik, AU020902, Ixl

UniProt

Q9DB91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Med29 Rabbit Polyclonal Antibody (orb585346) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080318

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CENPP Rabbit Polyclonal Antibody
TA349790 100 µL

CENPP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GENLISA™ Human GENLISA™ Human Spermine ELISA
KBH0625 1x 96 Well

GENLISA™ Human GENLISA™ Human Spermine ELISA

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 4 (FGF4) ELISA Kit
NSL0549r 96 Tests

Rat Fibroblast Growth Factor 4 (FGF4) ELISA Kit

Sign In for Pricing
View Details
Olfr1269 (NM_146342) Mouse Tagged Lenti ORF Clone
MR212554L3 10 µg

Olfr1269 (NM_146342) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
WIPI-4 (G-12) Alexa Fluor® 790
sc-398272 AF790 200 µg/mL

WIPI-4 (G-12) Alexa Fluor® 790

Sign In for Pricing
View Details
IRF2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV621239 1.0 µg DNA

IRF2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details