Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Med29 Peptide - middle region

Med29 Peptide - middle region

Product Specifications

Product Name Alternative

2810405O22Rik, AU020902, Ixl

UniProt

Q9DB91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Med29 Rabbit Polyclonal Antibody (orb585346) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080318

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eupteleasaponin I
TBW00354 10mg

Eupteleasaponin I

Sign In for Pricing
View Details
Human CHURC1-FNTB Knockout A549 cell line
GTR15414841 1 Vial

Human CHURC1-FNTB Knockout A549 cell line

Sign In for Pricing
View Details
Human MLLT10 knockdown cell line
ABC-KD9336 1 Vial

Human MLLT10 knockdown cell line

Sign In for Pricing
View Details
c Maf (MAF) (NM_005360) Human Untagged Clone
SC116772 10 µg

c Maf (MAF) (NM_005360) Human Untagged Clone

Sign In for Pricing
View Details
KHDC1 ORF Vector (Human) (pORF)
ORF005584 1.0 µg DNA

KHDC1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ECFP Mouse mAb, BF488 conjugated
orb2368751 100 µL

ECFP Mouse mAb, BF488 conjugated

Sign In for Pricing
View Details