Fahd2a Peptide - C-terminal region
Fahd2a Peptide - C-terminal region
Product Specifications
Product Name Alternative
1500003K14Rik, B430104H02Rik, Cgi-105, Fahd2
UniProt
Q3TC72
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fahd2a Rabbit Polyclonal Antibody (orb585367) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_083905
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VSQFVTLYPGDLLLTGTPPGVGMFRKPPVFLKKGDEVQCEIEELGVIINK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680040-500 1x 500 µL
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940204-100 1x 100 µL
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740955-500 1x 500 µL
Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details