Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arl9 Peptide - C-terminal region

Arl9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1700110A09Rik

UniProt

Q6IMB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arl9 Rabbit Polyclonal Antibody (orb326440) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_996818

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EMYLPKGWLLIFVVDSADHKRLPEAKKYLHQLINPNPGLPLVVFANKQVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIRC60 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV740692 1.0 µg DNA

PIRC60 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Dtd1 (NM_025314) Mouse Untagged Clone
MC201830 10 µg

Dtd1 (NM_025314) Mouse Untagged Clone

Sign In for Pricing
View Details
CDC25B CRISPR All-in-one AAV vector set (with saCas9)(Rat)
15603156 3x 1.0 µg DNA

CDC25B CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Anti-USP37
orb1124731 100 µL

Anti-USP37

Sign In for Pricing
View Details
Human HCGβ Matched Antibody Pair Set [ABP-S-05916]
ABP-S-05916 5 Plates

Human HCGβ Matched Antibody Pair Set [ABP-S-05916]

Sign In for Pricing
View Details
Sodium 2-Morpholinoethanesulfonate Monohydrate
OR1067370 5 g

Sodium 2-Morpholinoethanesulfonate Monohydrate

Sign In for Pricing
View Details