Arl9 Peptide - C-terminal region
Arl9 Peptide - C-terminal region
Product Specifications
Product Name Alternative
1700110A09Rik
UniProt
Q6IMB2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Arl9 Rabbit Polyclonal Antibody (orb326440) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_996818
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EMYLPKGWLLIFVVDSADHKRLPEAKKYLHQLINPNPGLPLVVFANKQVF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RR214455L3V 200 µL
Tube1 (NM_001108536) Rat Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
K2501506 1.0 µg DNA
TRNAL17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details MBS1131464-01 0.02 mg (E-Coli)
Recombinant Francisella tularensis subsp. mediasiatica Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)
Sign In for Pricing
View Details MBS1131464-02 0.02 mg (Yeast)
Recombinant Francisella tularensis subsp. mediasiatica Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)
Sign In for Pricing
View Details MBS1131464-03 0.1 mg (E-Coli)
Recombinant Francisella tularensis subsp. mediasiatica Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)
Sign In for Pricing
View Details