Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MINDY3 Peptide - N-terminal region

MINDY3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Fam188a, RGD1309605

UniProt

D3Z916

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MINDY3 Rabbit Polyclonal Antibody (orb585417) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099592

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CAVIAPVQAFLLKKLLFSSEKSSWRDCSEDEQKELLCHTLCDILESACDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF3 Polyclonal Antibody
MBS127230-01 0.02 mL

ATF3 Polyclonal Antibody

Sign In for Pricing
View Details
ATF3 Polyclonal Antibody
MBS127230-02 0.1 mL

ATF3 Polyclonal Antibody

Sign In for Pricing
View Details
ATF3 Polyclonal Antibody
MBS127230-03 5x 0.1 mL

ATF3 Polyclonal Antibody

Sign In for Pricing
View Details
Alpha 4b siRNA (m)
sc-141029 10 µM

Alpha 4b siRNA (m)

Sign In for Pricing
View Details
Epithelial Dissociation System 2 (Epididymal epithelial, Gastric parietal and chief Submandibular salivary), Mouse and Rat
4-20252 Each

Epithelial Dissociation System 2 (Epididymal epithelial, Gastric parietal and chief Submandibular salivary), Mouse and Rat

Sign In for Pricing
View Details
Recombinant Human CD20/MS4A1 Protein, N-His
orb2969224-01 50 µg

Recombinant Human CD20/MS4A1 Protein, N-His

Sign In for Pricing
View Details