Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MINDY3 Peptide - N-terminal region

MINDY3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Fam188a, RGD1309605

UniProt

D3Z916

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MINDY3 Rabbit Polyclonal Antibody (orb585417) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099592

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CAVIAPVQAFLLKKLLFSSEKSSWRDCSEDEQKELLCHTLCDILESACDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-human IL-2RA mAb (ABD)
E4A09D32-ABD-100 100 µg

Human anti-human IL-2RA mAb (ABD)

Sign In for Pricing
View Details
Cab39 3'UTR Lenti-reporter-Luc Vector
14856084 1.0 µg

Cab39 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
MAP1LC3b AAV Vector (Human) (CMV)
28006102 1 µg

MAP1LC3b AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
STNL P003-150x50-AL-CRD/1 AC Signs
822197 Card of 1 Pictogram(s)

STNL P003-150x50-AL-CRD/1 AC Signs

Sign In for Pricing
View Details
Rabbit Monoclonal Carbonic Anhydrase VIII/CA8 Antibody (001) [Biotin]
NBP2-90709B 0.1 mL

Rabbit Monoclonal Carbonic Anhydrase VIII/CA8 Antibody (001) [Biotin]

Sign In for Pricing
View Details
Prr18 (NM_178774) Mouse Tagged Lenti ORF Clone
MR204333L3 10 µg

Prr18 (NM_178774) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details