Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mrpl22 Peptide - middle region

Mrpl22 Peptide - middle region

Product Specifications

Product Name Alternative

E030011D16Rik, HSPC158, MRP-L25, Rpml25

UniProt

Q8BU88

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mrpl22 Rabbit Polyclonal Antibody (orb585449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_778166

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSIDQALAQLEFNDKKGAQIIKEVLLEAQDMAVRDHNVEFRSNLHIAEST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKY1 Antibody
orb851260 2 mg

SKY1 Antibody

Sign In for Pricing
View Details
SOD1-Derlin-1 Inhibitor 56-26
orb1737676-01 25 mg

SOD1-Derlin-1 Inhibitor 56-26

Sign In for Pricing
View Details
SOD1-Derlin-1 Inhibitor 56-26
orb1737676-02 50 mg

SOD1-Derlin-1 Inhibitor 56-26

Sign In for Pricing
View Details
SOD1-Derlin-1 Inhibitor 56-26
orb1737676-03 100 mg

SOD1-Derlin-1 Inhibitor 56-26

Sign In for Pricing
View Details
Bovine IgG Antibody
orb345989 10 mg

Bovine IgG Antibody

Sign In for Pricing
View Details
KNG1 Rabbit Polyclonal Antibody (Biotin)
orb2099059 100 µL

KNG1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details