Sos1 Peptide - N-terminal region
Sos1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
4430401P03Rik, 9630010N06, AI449023
UniProt
Q62245
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Sos1 Rabbit Polyclonal Antibody (orb585605) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_033257
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YFELLKQLEEKSEDQEDKECMKQAITALLNVQSGMEKICSKSLAKRRLSE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400821-500 1x 500 µL
Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 