Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sos1 Peptide - N-terminal region

Sos1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4430401P03Rik, 9630010N06, AI449023

UniProt

Q62245

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sos1 Rabbit Polyclonal Antibody (orb585605) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033257

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YFELLKQLEEKSEDQEDKECMKQAITALLNVQSGMEKICSKSLAKRRLSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nintedanib Dimer Impurity
TRC-N478305-1MG 1 mg

Nintedanib Dimer Impurity

Sign In for Pricing
View Details
1-(5-Fluoropentyl)-N-(naphthalen-2-yl)-1H-indole-2,4,5,6,7-3-carboxamide-d5
TRC-F742640-25MG 25 mg

1-(5-Fluoropentyl)-N-(naphthalen-2-yl)-1H-indole-2,4,5,6,7-3-carboxamide-d5

Sign In for Pricing
View Details
MAG Rabbit Polyclonal Antibody
TA368843 100 µL

MAG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KCNA6 Mouse Monoclonal Antibody [Clone ID: K19/36]
75-012 100 µL

KCNA6 Mouse Monoclonal Antibody [Clone ID: K19/36]

Sign In for Pricing
View Details
L-Asparagine-13C4, 15N2 Hydrate
TRC-A790038-0.5MG 0.5 mg

L-Asparagine-13C4, 15N2 Hydrate

Sign In for Pricing
View Details
Mouse Arhgap36 activation kit by CRISPRa
GA210199 1 Kit

Mouse Arhgap36 activation kit by CRISPRa

Sign In for Pricing
View Details