Abi3 Peptide - C-terminal region
Abi3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
2210414K06Rik, AI987680, NESH
UniProt
Q8BYZ1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Abi3 Rabbit Polyclonal Antibody (orb585672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079935
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DEPSWVPASYLEKVVTLYPYTRQKDNELSFSEGTVICVTRRYSDGWCEGV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC403041 20 µg
ABIN3 (TNIP3) (NM_024873) Human Over-expression Lysate
Sign In for Pricing
View Details 
![LIMS2 Mouse Monoclonal Antibody [Clone ID: OTI5H8]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908b2c/imageurl/cf811408.webp)
