Abi3 Peptide - C-terminal region
Abi3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
2210414K06Rik, AI987680, NESH
UniProt
Q8BYZ1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Abi3 Rabbit Polyclonal Antibody (orb585672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079935
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DEPSWVPASYLEKVVTLYPYTRQKDNELSFSEGTVICVTRRYSDGWCEGV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-N494125-50MG 50 mg
4-Nitrophenyl 4,6-O-Benzylidene-Alpha-D-mannopyranoside
Sign In for Pricing
View Details 
BNUB2375-500 1x 500 µL
Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), 0.2mg/mL
Sign In for Pricing
View Details 