COQ6 Peptide - N-terminal region
COQ6 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CGI10, COQ10D6
UniProt
Q9Y2Z9
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with COQ6 Rabbit Polyclonal Antibody (orb585887) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_872286
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ILLLEAGPKKVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRYRA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC427559 20 µg
BIGM103 (SLC39A8) (NM_001135146) Human Over-expression Lysate
Sign In for Pricing
View Details 
950 100 Tests
Green Fluorescent FAM-Leu-CMK Serine Protease Assay Kit
Sign In for Pricing
View Details 
BNC681803-100 1x 100 µL
GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB2524-100 1x 100 µL
SMAD4 (Pancreatic Adenocarcinoma Marker) (SMAD4/2524), 0.2mg/mL
Sign In for Pricing
View Details