COQ6 Peptide - N-terminal region
COQ6 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CGI10, COQ10D6
UniProt
Q9Y2Z9
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with COQ6 Rabbit Polyclonal Antibody (orb585887) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_872286
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ILLLEAGPKKVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRYRA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680853-100 1x 100 µL
P34 / cdk1 (POH-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
DY350-1901-1 1 mg
Dylight 350 Conjugated Phytolacca americana Lectin (Pokeweed) -PWM, PWA-
Sign In for Pricing
View Details 