Gpr4 Peptide - middle region
Gpr4 Peptide - middle region
Product Specifications
UniProt
Q8BUD0
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Gpr4 Rabbit Polyclonal Antibody (orb585891) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_783599
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LCYRGILRAVQSSVSTERQEKVKIKRLALSLIAIVLVCFAPYHALLLSRS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7619969-01 48 Well
Mouse Sectm1a (Secreted and transmembrane protein 1A) QuickTest ELISA Kit
Sign In for Pricing
View Details MBS7619969-02 96 Well
Mouse Sectm1a (Secreted and transmembrane protein 1A) QuickTest ELISA Kit
Sign In for Pricing
View Details