Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPNE8 Peptide - C-terminal region

CPNE8 Peptide - C-terminal region

Product Specifications

UniProt

Q86YQ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPNE8 Rabbit Polyclonal Antibody (orb586598) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_705898

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQTKESIVNASKLPMSIIIVGVGPAEFDAMVELDGDDVRVSSRGKYAERD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dual Purpose Incubator BIDP-201
BIDP-201 1 Unit

Dual Purpose Incubator BIDP-201

Sign In for Pricing
View Details
GRP94 Antibody
OC-976-01 50 μL

GRP94 Antibody

Sign In for Pricing
View Details
GRP94 Antibody
OC-976-02 100 µL

GRP94 Antibody

Sign In for Pricing
View Details
GRP94 Antibody
OC-976-03 1 mL

GRP94 Antibody

Sign In for Pricing
View Details
Mouse Epb42 activation kit by CRISPRa
GA201254 1 Kit

Mouse Epb42 activation kit by CRISPRa

Sign In for Pricing
View Details
TOB2 (N-term) Rabbit Polyclonal Antibody
AP13260PU-N 400 µL

TOB2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details