CPNE8 Peptide - C-terminal region
CPNE8 Peptide - C-terminal region
Product Specifications
UniProt
Q86YQ8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CPNE8 Rabbit Polyclonal Antibody (orb586598) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_705898
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AQTKESIVNASKLPMSIIIVGVGPAEFDAMVELDGDDVRVSSRGKYAERD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB0181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), 0.2mg/mL
Sign In for Pricing
View Details 
PKSH032977-01 10 µg
Recombinant Human Protocadherin-1/PCDH1 Protein (His Tag)
Sign In for Pricing
View Details PKSH032977-02 50 µg
Recombinant Human Protocadherin-1/PCDH1 Protein (His Tag)
Sign In for Pricing
View Details