Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lhfpl3 Peptide - C-terminal region

Lhfpl3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

A930031L14Rik

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lhfpl3 Rabbit Polyclonal Antibody (orb586618) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074700

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TATVYKICAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM29 (C-2) HRP
sc-376125 HRP 200 µg/mL

TRIM29 (C-2) HRP

Sign In for Pricing
View Details
Napsin-A (Biotin)
138575-AF-Biotin 100 µL

Napsin-A (Biotin)

Sign In for Pricing
View Details
AdmiRa-hsa-miR-6741-3p Virus
mh2356 250 µL

AdmiRa-hsa-miR-6741-3p Virus

Sign In for Pricing
View Details
L-b-Oleoyl-g-palmitoyl-a-lecithin
O-1410.1000 1.0g

L-b-Oleoyl-g-palmitoyl-a-lecithin

Sign In for Pricing
View Details
GFAP (E8S7G) Mouse Monoclonal Antibody
CST 95717T 20 µL

GFAP (E8S7G) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
POLA1 siRNA (Human)
CRH3625-01 15 nmol

POLA1 siRNA (Human)

Sign In for Pricing
View Details