Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lhfpl3 Peptide - C-terminal region

Lhfpl3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

A930031L14Rik

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lhfpl3 Rabbit Polyclonal Antibody (orb586618) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074700

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TATVYKICAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse AP-5 complex subunit beta-1 (Ap5b1) , partial
MBS1347723 Inquire

Recombinant Mouse AP-5 complex subunit beta-1 (Ap5b1) , partial

Sign In for Pricing
View Details
RASD2 antibody
70R-32069 0.1 mg

RASD2 antibody

Sign In for Pricing
View Details
TUSC5 Antibody
CSB-PA062014 100 µL

TUSC5 Antibody

Sign In for Pricing
View Details
Mouse Ras-related protein Rab-38, RAB38 ELISA Kit
MBS9327313-01 48 Well

Mouse Ras-related protein Rab-38, RAB38 ELISA Kit

Sign In for Pricing
View Details
Mouse Ras-related protein Rab-38, RAB38 ELISA Kit
MBS9327313-02 96 Well

Mouse Ras-related protein Rab-38, RAB38 ELISA Kit

Sign In for Pricing
View Details
Mouse Ras-related protein Rab-38, RAB38 ELISA Kit
MBS9327313-03 5x 96 Well

Mouse Ras-related protein Rab-38, RAB38 ELISA Kit

Sign In for Pricing
View Details