Nus1 Peptide - middle region
Nus1 Peptide - middle region
Product Specifications
Product Name Alternative
1600027K07Rik, AU019165, AW538011, BC003223, D10Ertd438e
UniProt
Q99LJ8
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Nus1 Rabbit Polyclonal Antibody (orb326620) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_084526
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RLMDEILKQQQELLGQDCSKYSAEFANSNDKDDQDLNCPSAVKVLSPEDG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2886617-01 48 Well
Pig Nitric oxide synthase, inducible ELISA Kit
Sign In for Pricing
View Details MBS2886617-02 96 Well
Pig Nitric oxide synthase, inducible ELISA Kit
Sign In for Pricing
View Details MBS2886617-03 5x 96 Well
Pig Nitric oxide synthase, inducible ELISA Kit
Sign In for Pricing
View Details MBS2886617-04 10x 96 Well
Pig Nitric oxide synthase, inducible ELISA Kit
Sign In for Pricing
View Details 