Spag7 Peptide - N-terminal region
Spag7 Peptide - N-terminal region
Product Specifications
Product Name Alternative
5730443G10, ACRP, FSA-1, Fsa1l
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Spag7 Rabbit Polyclonal Antibody (orb586648) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001161141
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MADLLGSILSSMEKPPSLGDQESRRKAREQAARLKKLQEQDKQQKVEFRK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog