Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Suclg2 Peptide - N-terminal region

Suclg2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AF171077, AW556404, D6Wsu120e

UniProt

Q9Z2I8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Suclg2 Rabbit Polyclonal Antibody (orb331362) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035637

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKGGVHLTKDPKVVGELAQQMIGYNLATKQTPKEGVKVNKVMVAEALDIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhox6 Mouse Gene Knockout Kit (CRISPR)
KN514806 1 Kit

Rhox6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant CD1a Antibody
RC-15657-01 50 μL

Recombinant CD1a Antibody

Sign In for Pricing
View Details
Recombinant CD1a Antibody
RC-15657-02 100 µL

Recombinant CD1a Antibody

Sign In for Pricing
View Details
Recombinant CD1a Antibody
RC-15657-03 1 mL

Recombinant CD1a Antibody

Sign In for Pricing
View Details
Human DIO1 activation kit by CRISPRa
GA101202 1 Kit

Human DIO1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human FBXL15 activation kit by CRISPRa
GA112405 1 Kit

Human FBXL15 activation kit by CRISPRa

Sign In for Pricing
View Details