Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Suclg2 Peptide - N-terminal region

Suclg2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AF171077, AW556404, D6Wsu120e

UniProt

Q9Z2I8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Suclg2 Rabbit Polyclonal Antibody (orb331362) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035637

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKGGVHLTKDPKVVGELAQQMIGYNLATKQTPKEGVKVNKVMVAEALDIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIBU 1361 Dihydrochloride
TRC-B377008-2.5MG 2.5 mg

BIBU 1361 Dihydrochloride

Sign In for Pricing
View Details
Kap (NM_010594) Mouse Tagged ORF Clone
MG200597 10 µg

Kap (NM_010594) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CCDC98 Recombinant Rabbit Monoclonal Antibody [JE62-73]
HA720094 100 µL

CCDC98 Recombinant Rabbit Monoclonal Antibody [JE62-73]

Sign In for Pricing
View Details
6beta-Hydroxy-3alpha,5alpha-cycloandrostan-17-one
TRC-H925500-2.5MG 2.5 mg

6beta-Hydroxy-3alpha,5alpha-cycloandrostan-17-one

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS504199 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Freeze Dryer BFBT-105-B
BFBT-105-B 1 Unit

Freeze Dryer BFBT-105-B

Sign In for Pricing
View Details