Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tuft1 Peptide - middle region

Tuft1 Peptide - middle region

Product Specifications

UniProt

O08970

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tuft1 Rabbit Polyclonal Antibody (orb326625) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035786

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSRYQREAEQSNVALQREEDRVEQKAAEIEELQRRLLGMEAEHQALLVKV

More Discoveries

Explore Other Products

Browse additional items from our catalog

BOCT Rabbit Polyclonal Antibody
MBS9512116-01 0.05 mL

BOCT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BOCT Rabbit Polyclonal Antibody
MBS9512116-02 0.1 mL

BOCT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BOCT Rabbit Polyclonal Antibody
MBS9512116-03 5x 0.1 mL

BOCT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRRG3 protein, Human, Recombinant (His)
E51P91325 20 µg

PRRG3 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
OKRC00037-96W - IL-10 ELISA Kit (Cow)
OKRC00037-96W 96 Well

OKRC00037-96W - IL-10 ELISA Kit (Cow)

Sign In for Pricing
View Details
Carbonic Anhydrase I (CA1) (NM_001291968) Human Tagged ORF Clone
RC236064 10 µg

Carbonic Anhydrase I (CA1) (NM_001291968) Human Tagged ORF Clone

Sign In for Pricing
View Details