Tuft1 Peptide - middle region
Tuft1 Peptide - middle region
Product Specifications
UniProt
O08970
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tuft1 Rabbit Polyclonal Antibody (orb326625) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_035786
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSRYQREAEQSNVALQREEDRVEQKAAEIEELQRRLLGMEAEHQALLVKV
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9352608-01 48 Well
Mouse Receptor-Interacting Serine/Threonine-Protein Kinase 3 (RIPK3) ELISA Kit
Sign In for Pricing
View Details MBS9352608-02 96 Well
Mouse Receptor-Interacting Serine/Threonine-Protein Kinase 3 (RIPK3) ELISA Kit
Sign In for Pricing
View Details MBS9352608-03 5x 96 Well
Mouse Receptor-Interacting Serine/Threonine-Protein Kinase 3 (RIPK3) ELISA Kit
Sign In for Pricing
View Details MBS9352608-04 10x 96 Well
Mouse Receptor-Interacting Serine/Threonine-Protein Kinase 3 (RIPK3) ELISA Kit
Sign In for Pricing
View Details ![Rabbit Polyclonal PF1 Antibody [CoraFluor 1]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)