Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gm13194 Peptide - middle region

Gm13194 Peptide - middle region

Product Specifications

Product Name Alternative

OTTMUSG00000010821

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gm13194 Rabbit Polyclonal Antibody (orb326646) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_355309

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSLYAQRKRRYDRKRSGYGGQTKPIFCKKAKTTKKIVLTLECVEPNCRSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAP1L1 Rabbit Monoclonal Antibody
orb866361 100 µL

NAP1L1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Pdlim7 shRNA (UAS) - Lentiviral mouse Pdlim7 shRNA (UAS, RFP) (100)
GTR15183396 1 Vial

Lentiviral mouse Pdlim7 shRNA (UAS) - Lentiviral mouse Pdlim7 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
pCMV-SPORT6-TBC1D7 Plasmid
PVT22648 2 µg

pCMV-SPORT6-TBC1D7 Plasmid

Sign In for Pricing
View Details
Pyridostatin TFA
MBS3608034-01 2 mg

Pyridostatin TFA

Sign In for Pricing
View Details
Pyridostatin TFA
MBS3608034-02 5 mg

Pyridostatin TFA

Sign In for Pricing
View Details
Pyridostatin TFA
MBS3608034-03 10 mg

Pyridostatin TFA

Sign In for Pricing
View Details