Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gm13194 Peptide - middle region

Gm13194 Peptide - middle region

Product Specifications

Product Name Alternative

OTTMUSG00000010821

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gm13194 Rabbit Polyclonal Antibody (orb326646) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_355309

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSLYAQRKRRYDRKRSGYGGQTKPIFCKKAKTTKKIVLTLECVEPNCRSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOBP Antibody
orb417831-01 50 µg

MOBP Antibody

Sign In for Pricing
View Details
MOBP Antibody
orb417831-02 100 µg

MOBP Antibody

Sign In for Pricing
View Details
[KO Validated] NUP210 Rabbit pAb (APR29461N)
APR29461N-01 50 µL

[KO Validated] NUP210 Rabbit pAb (APR29461N)

Sign In for Pricing
View Details
[KO Validated] NUP210 Rabbit pAb (APR29461N)
APR29461N-02 100 µL

[KO Validated] NUP210 Rabbit pAb (APR29461N)

Sign In for Pricing
View Details
[KO Validated] NUP210 Rabbit pAb (APR29461N)
APR29461N-03 200 µL

[KO Validated] NUP210 Rabbit pAb (APR29461N)

Sign In for Pricing
View Details
Mouse Brain Abundant, Membrane Attached Signal Protein 1 (BASP1) ELISA Kit
orb2810243-01 48 Tests

Mouse Brain Abundant, Membrane Attached Signal Protein 1 (BASP1) ELISA Kit

Sign In for Pricing
View Details