Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sfxn5 Peptide - N-terminal region

Sfxn5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BBG-TCC

UniProt

Q8CFD0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sfxn5 Rabbit Polyclonal Antibody (orb586742) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_695210

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NEQLWSAQKIKQAILHPDTNEKIFMPFRMSGYIPFGTPIVVGLLLPNQTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL43 Conjugated Antibody
MBS9453671-01 0.1 mL (AF350)

MRPL43 Conjugated Antibody

Sign In for Pricing
View Details
MRPL43 Conjugated Antibody
MBS9453671-02 0.1 mL (AF405)

MRPL43 Conjugated Antibody

Sign In for Pricing
View Details
MRPL43 Conjugated Antibody
MBS9453671-03 0.1 mL (AF488)

MRPL43 Conjugated Antibody

Sign In for Pricing
View Details
MRPL43 Conjugated Antibody
MBS9453671-04 0.1 mL (AF555)

MRPL43 Conjugated Antibody

Sign In for Pricing
View Details
MRPL43 Conjugated Antibody
MBS9453671-05 0.1 mL (Biotin)

MRPL43 Conjugated Antibody

Sign In for Pricing
View Details
rno-miR-665 miRNA Mimic
MBS8302903-01 5 nmol

rno-miR-665 miRNA Mimic

Sign In for Pricing
View Details