Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sfxn5 Peptide - N-terminal region

Sfxn5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BBG-TCC

UniProt

Q8CFD0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sfxn5 Rabbit Polyclonal Antibody (orb586742) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_695210

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NEQLWSAQKIKQAILHPDTNEKIFMPFRMSGYIPFGTPIVVGLLLPNQTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1R,2R,3R) -3-[N- (4-Methoxybenzyl) imidomethylthiomethoxy]-1,2-dihydroxy-4-cyclopropene 1,2-Cyclohexyl Ketal
016042 10 mg

(1R,2R,3R) -3-[N- (4-Methoxybenzyl) imidomethylthiomethoxy]-1,2-dihydroxy-4-cyclopropene 1,2-Cyclohexyl Ketal

Sign In for Pricing
View Details
ACTH, NT (Adrenocorticotropic Hormone, Adrenocorticotropin, Corticotropin) (MaxLight 405) discontinued
A0758-07-ML405 100 µL

ACTH, NT (Adrenocorticotropic Hormone, Adrenocorticotropin, Corticotropin) (MaxLight 405) discontinued

Sign In for Pricing
View Details
EXOC1 AAV Vector (Human) (CMV)
19558101 1 µg

EXOC1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Neuroligin-1 Antibody, Clone N97A/31: ATTO 488
SMC-463D-A488 100 µg

Neuroligin-1 Antibody, Clone N97A/31: ATTO 488

Sign In for Pricing
View Details
Ultrasonic Cleaner Bath 10L
LQLEUCB10000000000 1 Unit

Ultrasonic Cleaner Bath 10L

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Transcription initiation factor TFIID subunit 4 (Taf4), partial
MBS1016588 Inquire

Recombinant Drosophila melanogaster Transcription initiation factor TFIID subunit 4 (Taf4), partial

Sign In for Pricing
View Details