Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFAND2B Peptide - N-terminal region

ZFAND2B Peptide - N-terminal region

Product Specifications

Product Name Alternative

AIRAPL

UniProt

Q8WV99

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZFAND2B Rabbit Polyclonal Antibody (orb587218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620157

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cars sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6594406 1.0 µg DNA

Cars sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
MYOZ2 siRNA (Mouse)
MBS8232931-01 15 nmol

MYOZ2 siRNA (Mouse)

Sign In for Pricing
View Details
MYOZ2 siRNA (Mouse)
MBS8232931-02 30 nmol

MYOZ2 siRNA (Mouse)

Sign In for Pricing
View Details
MYOZ2 siRNA (Mouse)
MBS8232931-03 5x 30 nmol

MYOZ2 siRNA (Mouse)

Sign In for Pricing
View Details
Lentiviral human GSTA5 sgRNA gene knockout kit - Lentiviral human GSTA5 sgRNA gene knockout kit (plasmid)
GTR15354733 1 Vial

Lentiviral human GSTA5 sgRNA gene knockout kit - Lentiviral human GSTA5 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
KA1 CRISPR Activation Plasmid (h2)
sc-403522-ACT-2 20 µg

KA1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details