TMEM182 Peptide - N-terminal region
TMEM182 Peptide - N-terminal region
Product Specifications
UniProt
Q6ZP80
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMEM182 Rabbit Polyclonal Antibody (orb326866) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_653233
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ENDSNIWKFWYTNQPPSKNCTHAYLSPYPFMRGEHNSTSYDSAVIYRGFW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881081-100 1x 100 µL
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740158-100 1x 100 µL
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details