CARNMT1 Peptide - middle region
CARNMT1 Peptide - middle region
Product Specifications
Product Name Alternative
C9orf41, UPF0586
UniProt
Q8N4J0
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CARNMT1 Rabbit Polyclonal Antibody (orb587222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689633
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DGNGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYQPIIKEILKN
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS078214-01 48 Well
Camel Embryonic Ectoderm Development ELISA Kit
Sign In for Pricing
View Details MBS078214-02 96 Well
Camel Embryonic Ectoderm Development ELISA Kit
Sign In for Pricing
View Details MBS078214-03 5x 96 Well
Camel Embryonic Ectoderm Development ELISA Kit
Sign In for Pricing
View Details MBS078214-04 10x 96 Well
Camel Embryonic Ectoderm Development ELISA Kit
Sign In for Pricing
View Details 
MBS1363605 Inquire
Recombinant Shewanella sp. Sulfite reductase [NADPH] hemoprotein beta-component (cysI), partial
Sign In for Pricing
View Details