Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARNMT1 Peptide - middle region

CARNMT1 Peptide - middle region

Product Specifications

Product Name Alternative

C9orf41, UPF0586

UniProt

Q8N4J0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CARNMT1 Rabbit Polyclonal Antibody (orb587222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689633

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGNGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYQPIIKEILKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOHH Peptide - N-terminal region (AAP60855)
AAP60855-100UG 100 µg

DOHH Peptide - N-terminal region (AAP60855)

Sign In for Pricing
View Details
CCDC25 Antibody
C49102-01 40 µL

CCDC25 Antibody

Sign In for Pricing
View Details
CCDC25 Antibody
C49102-02 100 µL

CCDC25 Antibody

Sign In for Pricing
View Details
CCDC25 Antibody
C49102-03 200 µL

CCDC25 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS707678 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Thieno[2',3':4,5]imidazo[1,2-a]pyridine-2-carboxylic acid
sc-356140A 5 g

Thieno[2',3':4,5]imidazo[1,2-a]pyridine-2-carboxylic acid

Sign In for Pricing
View Details