Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF151 Peptide - middle region

RNF151 Peptide - middle region

Product Specifications

UniProt

Q2KHN1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF151 Rabbit Polyclonal Antibody (orb326874) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777563

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHRKGHQDSCPFELTACPNEGCTSQVPRGTLAEHRQHCQQGSQQRCPLGC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cefazolin Tetrazolyl Acetamide Acetal
RM-C062702-01 10 mg

Cefazolin Tetrazolyl Acetamide Acetal

Sign In for Pricing
View Details
Cefazolin Tetrazolyl Acetamide Acetal
RM-C062702-02 100 mg

Cefazolin Tetrazolyl Acetamide Acetal

Sign In for Pricing
View Details
Cefazolin Tetrazolyl Acetamide Acetal
RM-C062702-03 25 mg

Cefazolin Tetrazolyl Acetamide Acetal

Sign In for Pricing
View Details
Cefazolin Tetrazolyl Acetamide Acetal
RM-C062702-04 50 mg

Cefazolin Tetrazolyl Acetamide Acetal

Sign In for Pricing
View Details
Human BMP6 Protein
orb424354-01 2 µg

Human BMP6 Protein

Sign In for Pricing
View Details
Human BMP6 Protein
orb424354-02 10 µg

Human BMP6 Protein

Sign In for Pricing
View Details