Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YDJC Peptide - C-terminal region

YDJC Peptide - C-terminal region

Product Specifications

UniProt

A8MPS7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YDJC Rabbit Polyclonal Antibody (orb587236) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017964

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAHRVSGALARVLEGTLAGHTLTAELMAHPGYPSVPPTGGCGEGPDAFSC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DYNLT3 activation kit by CRISPRa
GA104806 1 Kit

Human DYNLT3 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: rectosigmoid
CS706286 5x 5 µm

Tissue FFPE Sections, Colon: rectosigmoid

Sign In for Pricing
View Details
Stx5a Mouse Gene Knockout Kit (CRISPR)
KN516932 1 Kit

Stx5a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Collagen I (COL1A1) (1021-1108) Mouse Monoclonal Antibody [Clone ID: 3G3]
AM31694PU-N 50 µg

Collagen I (COL1A1) (1021-1108) Mouse Monoclonal Antibody [Clone ID: 3G3]

Sign In for Pricing
View Details
2-Amino-6-bromopyridine
TRC-A601945-25G 25 g

2-Amino-6-bromopyridine

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS708485 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details