Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YDJC Peptide - C-terminal region

YDJC Peptide - C-terminal region

Product Specifications

UniProt

A8MPS7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YDJC Rabbit Polyclonal Antibody (orb587236) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017964

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAHRVSGALARVLEGTLAGHTLTAELMAHPGYPSVPPTGGCGEGPDAFSC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human B4GALT3 Protein (His Tag)
PKSH033258-01 10 µg

Recombinant Human B4GALT3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human B4GALT3 Protein (His Tag)
PKSH033258-02 50 µg

Recombinant Human B4GALT3 Protein (His Tag)

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2923), CF405S conjugate, 0.1mg/mL
BNC042923-100 1x 100 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2923), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PHGDH activation kit by CRISPRa
GA108803 1 Kit

Human PHGDH activation kit by CRISPRa

Sign In for Pricing
View Details
PCTAIRE1 Recombinant Rabbit Monoclonal Antibody [JE64-55]
HA721964 100 µL

PCTAIRE1 Recombinant Rabbit Monoclonal Antibody [JE64-55]

Sign In for Pricing
View Details
RNF14 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C9]
TA811050BM 100 µL

RNF14 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C9]

Sign In for Pricing
View Details