Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAAP20 Peptide - C-terminal region

FAAP20 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FP7162, C1orf86

UniProt

Q6NZ36

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAAP20 Rabbit Polyclonal Antibody (orb587247) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872339

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARSLPQRPAPDPCRAPRVEQQPSVEGAAALRSCPMCQKEFAPRLTQLDVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALR2 Antibody
8G268-AAT 50 µg

GALR2 Antibody

Sign In for Pricing
View Details
DCTD Rabbit Polyclonal Antibody
TA365729 100 µL

DCTD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GGA1 (NM_001001560) Human Over-expression Lysate
LY424381 100 µg

GGA1 (NM_001001560) Human Over-expression Lysate

Sign In for Pricing
View Details
Tris(2-chloroethyl)phosphate-d12
TRC-T875502-25MG 25 mg

Tris(2-chloroethyl)phosphate-d12

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS621000 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS801822 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details