FAAP20 Peptide - C-terminal region
FAAP20 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FP7162, C1orf86
UniProt
Q6NZ36
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FAAP20 Rabbit Polyclonal Antibody (orb587247) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_872339
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ARSLPQRPAPDPCRAPRVEQQPSVEGAAALRSCPMCQKEFAPRLTQLDVD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941990-500 1x 500 µL
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (KRT10/1990R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
ICH1139-50mg 50 mg
Anti-Mouse PD-L2 (TY25) In Vivo Antibody - Low Endotoxin
Sign In for Pricing
View Details 
