Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C4orf34 Peptide - N-terminal region

C4orf34 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C4orf34

UniProt

Q96QK8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C4orf34 Rabbit Polyclonal Antibody (orb587249) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777581

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAWM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTF-1 / NKX2.1 (NX2.1/690), CF568 conjugate, 0.1mg/mL
BNC680690-100 1x 100 µL

TTF-1 / NKX2.1 (NX2.1/690), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QB / Complement C1q B-Chain (C1QB/2961), CF647 conjugate, 0.1mg/mL
BNC472961-100 1x 100 µL

C1QB / Complement C1q B-Chain (C1QB/2961), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PAb240), CF568 conjugate, 0.1mg/mL
BNC681634-100 1x 100 µL

P53 Tumor Suppressor Protein (PAb240), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WIPI2 (2A2), CF740 conjugate, 0.1mg/mL
BNC742904-500 1x 500 µL

WIPI2 (2A2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-100 1x 100 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), 1mg/mL
BNUM0152-50 1x 50 µL

CD11c (HC1/1), 1mg/mL

Sign In for Pricing
View Details