Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCZ1B Peptide - N-terminal region

CCZ1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

C7orf28B, H_NH0577018.2

UniProt

P86790

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCZ1B Rabbit Polyclonal Antibody (orb326885) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_932765

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEENFWMVMVVRNPIIEKQSKDGKPVIEYQEEELLDKVYSSVLRQCYSMY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIMAP4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C6]
TA504849AM 100 µL

GIMAP4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C6]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS710449 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
9-Hydroxy Benzopyrene
TRC-H829410-1MG 1 mg

9-Hydroxy Benzopyrene

Sign In for Pricing
View Details
Two pore calcium channel protein 2 (TPCN2) Human Gene Knockout Kit (CRISPR)
KN209023LP 1 Kit

Two pore calcium channel protein 2 (TPCN2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTFE-Coated Sealing Mats
MAT-RD-750-PTFE 50 Pack/Case

PTFE-Coated Sealing Mats

Sign In for Pricing
View Details
PFN3 (NM_001029886) Human Over-expression Lysate
LY422264 100 µg

PFN3 (NM_001029886) Human Over-expression Lysate

Sign In for Pricing
View Details