Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCZ1B Peptide - N-terminal region

CCZ1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

C7orf28B, H_NH0577018.2

UniProt

P86790

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCZ1B Rabbit Polyclonal Antibody (orb326885) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_932765

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEENFWMVMVVRNPIIEKQSKDGKPVIEYQEEELLDKVYSSVLRQCYSMY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGN46 Recombinant Rabbit Monoclonal Antibody [JF1-024]
ET1702-56 100 µL

TGN46 Recombinant Rabbit Monoclonal Antibody [JF1-024]

Sign In for Pricing
View Details
XRCC1 (NM_006297) Human Over-expression Lysate
LC401897 20 µg

XRCC1 (NM_006297) Human Over-expression Lysate

Sign In for Pricing
View Details
Usp14 Mouse Gene Knockout Kit (CRISPR)
KN518769 1 Kit

Usp14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Xg blood group (XG) (NM_175569) Human Recombinant Protein
TP761179 50 µg

Xg blood group (XG) (NM_175569) Human Recombinant Protein

Sign In for Pricing
View Details
Phytase Microplate Assay Kit
RDSM141 100 Assays

Phytase Microplate Assay Kit

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF568 conjugate, 0.1mg/mL
BNC682460-100 1x 100 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details