ANKRD18A Peptide - N-terminal region
ANKRD18A Peptide - N-terminal region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ANKRD18A Rabbit Polyclonal Antibody (orb587266) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_671728
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VASEEKQERLQRSENKQPQDSQSYGKKKDAMYGNFMLKKDIAMLKEELYA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CDCA7L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A2]](https://cdn.genprice.uk/products/937/6868c3a1994c49e6dc3fbcf3/imageurl/ta803021bm.webp)
TA803021BM 100 µL
CDCA7L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A2]
Sign In for Pricing
View Details 
LY419670 100 µg
NG2 (CSPG4) (NM_001897) Human Over-expression Lysate
Sign In for Pricing
View Details 
FA-2357-2 2 mL
FITC Conjugated Rabbit Polyclonal Antibody to Goat IgG
Sign In for Pricing
View Details 
