Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C12orf74 Peptide - N-terminal region

C12orf74 Peptide - N-terminal region

Product Specifications

UniProt

F5H4P0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C12orf74 Rabbit Polyclonal Antibody (orb326900) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171568

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPTLRRLRTRGCGTRQDAWQVTTWGSWGAPVGFPCYLSKSLPGSPKDSSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
BNC400043-500 1x 500 µL

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-500 1x 500 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), CF740 conjugate, 0.1mg/mL
BNC741824-500 1x 500 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 3 (M3.1), CF488A conjugate, 0.1mg/mL
BNC880990-100 1x 100 µL

Mucin 3 (M3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM29 (TRIM29/1041), CF594 conjugate, 0.1mg/mL
BNC941041-500 1x 500 µL

TRIM29 (TRIM29/1041), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54), CF740 conjugate, 0.1mg/mL
BNC740054-100 1x 100 µL

HCG-beta (HCGb/54), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details