Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35F4 Peptide - C-terminal region

SLC35F4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf36, c14_5373

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC35F4 Rabbit Polyclonal Antibody (orb326905) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001193849

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLMLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pEGFP-C3-RIG-I Plasmid
PVTB00424-2b 2 µg

pEGFP-C3-RIG-I Plasmid

Sign In for Pricing
View Details
XAB1 (GPN1) (NM_007266) Human Recombinant Protein
PROTQ9HCN4 20 µg

XAB1 (GPN1) (NM_007266) Human Recombinant Protein

Sign In for Pricing
View Details
LGALS1 ELISA Kit (Rat) (OKCD01147)
OKCD01147 96 Well

LGALS1 ELISA Kit (Rat) (OKCD01147)

Sign In for Pricing
View Details
CLN5 Knockout A549 Polyclonal Cells
ARG10925 1 Million

CLN5 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
ATF5, CT (ATF5, ATFX, Cyclic AMP-dependent transcription factor ATF-5, Activating transcription factor 5, Transcription factor ATFx) (MaxLight 405) discontinued
032163-ML405 100 µL

ATF5, CT (ATF5, ATFX, Cyclic AMP-dependent transcription factor ATF-5, Activating transcription factor 5, Transcription factor ATFx) (MaxLight 405) discontinued

Sign In for Pricing
View Details
TARS (Threonyl tRNA Synthetase) Human ELISA Kit
H4653 96 Tests

TARS (Threonyl tRNA Synthetase) Human ELISA Kit

Sign In for Pricing
View Details