Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAC2 Peptide - N-terminal region

STAC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

24b2, 24b2/STAC2

UniProt

Q6ZMT1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STAC2 Rabbit Polyclonal Antibody (orb587287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_945344

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NALP12 (NLRP12) activation kit by CRISPRa
GA114138 1 Kit

Human NALP12 (NLRP12) activation kit by CRISPRa

Sign In for Pricing
View Details
SS-B Antibody
F48219-0.4ML 0.4 mL

SS-B Antibody

Sign In for Pricing
View Details
Carfilzomib (2R,4S)-2-Hydroxy Acetate
TRC-M687545-10MG 10 mg

Carfilzomib (2R,4S)-2-Hydroxy Acetate

Sign In for Pricing
View Details
NMDAR2B Rabbit Polyclonal Antibody
HA500208 100 µL

NMDAR2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cnbd2 Mouse Gene Knockout Kit (CRISPR)
KN503532 1 Kit

Cnbd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD29 (Stem Cell Marker) (12G10), CF405S conjugate, 0.1mg/mL
BNC042905-100 1x 100 µL

CD29 (Stem Cell Marker) (12G10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details