STAC2 Peptide - N-terminal region
STAC2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
24b2, 24b2/STAC2
UniProt
Q6ZMT1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with STAC2 Rabbit Polyclonal Antibody (orb587287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_945344
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLEN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY402258 100 µg
DPP2 (DPP7) (NM_013379) Human Over-expression Lysate
Sign In for Pricing
View Details 
KN220079RB 1 Kit
Wilms Tumor Protein (WT1) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details