Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKL4 Peptide - N-terminal region

CDKL4 Peptide - N-terminal region

Product Specifications

UniProt

Q5MAI5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDKL4 Rabbit Polyclonal Antibody (orb587288) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001009565

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PRKAA2 Protein, N-His
AP91811 50 µg

Recombinant Human PRKAA2 Protein, N-His

Sign In for Pricing
View Details
Human CXCR1 (NM_000634) AAV Particle
RC207019A1V 250 µL

Human CXCR1 (NM_000634) AAV Particle

Sign In for Pricing
View Details
Kv1.1 antibody
70R-49959 100 µL

Kv1.1 antibody

Sign In for Pricing
View Details
RGS3 (NM_021106) Human Untagged Clone
SC112965 10 µg

RGS3 (NM_021106) Human Untagged Clone

Sign In for Pricing
View Details
Human Monoclonal IL-1 alpha/IL-1F1 Antibody (Hu146) [DyLight 550]
FAB10568L 0.1 mL

Human Monoclonal IL-1 alpha/IL-1F1 Antibody (Hu146) [DyLight 550]

Sign In for Pricing
View Details
Rabbit Monoclonal DLL4 Antibody (003)
NBP2-89311-100ul 100 µL

Rabbit Monoclonal DLL4 Antibody (003)

Sign In for Pricing
View Details