Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKL4 Peptide - N-terminal region

CDKL4 Peptide - N-terminal region

Product Specifications

UniProt

Q5MAI5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDKL4 Rabbit Polyclonal Antibody (orb587288) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001009565

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GAPDH Loading Control Monoclonal
G041-1mg 1 mg

Anti-GAPDH Loading Control Monoclonal

Sign In for Pricing
View Details
PRMT6 (NM_018137) Human Over-expression Lysate
LY413290 100 µg

PRMT6 (NM_018137) Human Over-expression Lysate

Sign In for Pricing
View Details
C/EBP alpha, phosphorylated (S193) (CCAAT/Enhancer-Binding Protein alpha, C/EBP alpha, CEBPA, C/EBP alpha, C/EBPalpha) discontinued
221205-01 50 µL

C/EBP alpha, phosphorylated (S193) (CCAAT/Enhancer-Binding Protein alpha, C/EBP alpha, CEBPA, C/EBP alpha, C/EBPalpha) discontinued

Sign In for Pricing
View Details
C/EBP alpha, phosphorylated (S193) (CCAAT/Enhancer-Binding Protein alpha, C/EBP alpha, CEBPA, C/EBP alpha, C/EBPalpha) discontinued
221205-02 100 µL

C/EBP alpha, phosphorylated (S193) (CCAAT/Enhancer-Binding Protein alpha, C/EBP alpha, CEBPA, C/EBP alpha, C/EBPalpha) discontinued

Sign In for Pricing
View Details
Olfr459 Double Nickase Plasmid (m)
sc-434704-NIC 20 µg

Olfr459 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Anti-Aquaporin 3 Picoband Antibody
MBS1750750-01 0.01 mg

Anti-Aquaporin 3 Picoband Antibody

Sign In for Pricing
View Details