Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSANTD1 Peptide - C-terminal region

MSANTD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C4orf44

UniProt

Q6ZTZ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSANTD1 Rabbit Polyclonal Antibody (orb326907) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001036155

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLSPPAKSTPLYFPYNQCSYEGRFEDDRSDSSSSLLSLKFRSEERPVKKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hex (HHEX) (NM_002729) Human Over-expression Lysate
LS003087-100ug 100 µg

Hex (HHEX) (NM_002729) Human Over-expression Lysate

Sign In for Pricing
View Details
GTPBP3 Rabbit pAb, PerCP-Cy7 conjugated
orb2871221 100 µL

GTPBP3 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Human Aflatoxin B1 aldehyde reductase member 3 ELISA Kit
MBS9428425-01 96 Tests

Human Aflatoxin B1 aldehyde reductase member 3 ELISA Kit

Sign In for Pricing
View Details
Human Aflatoxin B1 aldehyde reductase member 3 ELISA Kit
MBS9428425-02 5x 96 Tests

Human Aflatoxin B1 aldehyde reductase member 3 ELISA Kit

Sign In for Pricing
View Details
50mL Pipette Individually Wrappd Plastic
170369N 100 / PCK

50mL Pipette Individually Wrappd Plastic

Sign In for Pricing
View Details
DPH1 (Diphthamide Biosynthesis Protein 1, DPH2-like 1, DPH2L1, DPH2L, FLJ33211, Ovarian Cancer Associated Gene 1, OVCA1) (MaxLight 650)
125995-ML650 100 µL

DPH1 (Diphthamide Biosynthesis Protein 1, DPH2-like 1, DPH2L1, DPH2L, FLJ33211, Ovarian Cancer Associated Gene 1, OVCA1) (MaxLight 650)

Sign In for Pricing
View Details