Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSANTD1 Peptide - C-terminal region

MSANTD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C4orf44

UniProt

Q6ZTZ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSANTD1 Rabbit Polyclonal Antibody (orb326907) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001036155

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLSPPAKSTPLYFPYNQCSYEGRFEDDRSDSSSSLLSLKFRSEERPVKKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IC Anion Std Oxalate 100ppm in H2O - 100ML
ICAU13 100 mL

IC Anion Std Oxalate 100ppm in H2O - 100ML

Sign In for Pricing
View Details
Neprilysin/CD10 ELISA Kit (Mouse) (OKBB00453)
OKBB00453 96 Well

Neprilysin/CD10 ELISA Kit (Mouse) (OKBB00453)

Sign In for Pricing
View Details
APC Anti-Mouse NK1.1 (CD161) (PK136)
orb1215547-01 25 µg

APC Anti-Mouse NK1.1 (CD161) (PK136)

Sign In for Pricing
View Details
APC Anti-Mouse NK1.1 (CD161) (PK136)
orb1215547-02 100 µg

APC Anti-Mouse NK1.1 (CD161) (PK136)

Sign In for Pricing
View Details
Ltk (NM_206942) Mouse Untagged Clone
MC221855 10 µg

Ltk (NM_206942) Mouse Untagged Clone

Sign In for Pricing
View Details
GPI Polyclonal Antibody, RBITC Conjugated
bs-10419R-RBITC 100 µL

GPI Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details